VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

SKU T76250-5 mg Category Brand:

For Research Use Only (RUO). This product is sold strictly for laboratory research use. Not for human or veterinary consumption, therapeutic, or diagnostic use.For sale to research organizations and laboratories only; not for patients or for personal use.

This product is currently out of stock and unavailable.

Products Details

Product Description

– VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, a 30-amino-acid peptide, mirrors the C-terminal domain of α2δ-1 and is recognized as the α2δ-1Tat peptide. It disrupts the α2δ-1 – NMDAR interaction both in vitro and in vivo, offering a potential research tool for neuropathic pain studies [1].
For Research Use Only (RUO). This product is sold strictly for laboratory research use only. Not for human or veterinary consumption, therapeutic, or diagnostic use. Any pharmacological, therapeutic, cosmetic, or biological effects described above are provided as research context only and do not represent intended or approved uses of this product.

Web ID

– T76250

Storage Temperature

– -20℃

Shipping

– Blue Ice

Molecular Formula

– C171H250N40O39

CAS Number

– 2279952-25-7

Molecular Weight

– C171H250N40O39

SMILES

– C([C@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC1=CC=CC=C1)NC([C@@H](NC([C@@H](NC(CNC([C@H](CC2=CC=CC=C2)NC([C@@H](NC([C@@H](NC([C@H](CC=3C=4C(NC3)=CC=CC4)NC([C@@H](NC([C@@H](NC(=O)[C@H]5N(C([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@H](C(C)C)N)=O)CO)=O)=O)CC(C)C)=O)CC(N)=O)=O)CCC5)CO)=O)CC(C)C)=O)=O)CO)=O)[C@H](CC)C)=O)=O)=O)CC(C)C)=O)CCC(N)=O)=O)=O)[C@H](CC)C)=O)CC(C)C)=O)CC(C)C)=O)C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@@H](CC6=CN=CN6)C(N[C@@H](CC7=CC=C(O)C=C7)C(N[C@H](C(N[C@@H](CC=8C=9C(NC8)=CC=CC9)C(O)=O)=O)CC(C)C)=O)=O)=O)CCCNC(=N)N)=O)CO)=O)=O)CO)=O)C(C)C)=O)CC(C)C)=O)C=%10C=%11C(NC%10)=CC=CC%11

Product type

– Peptide

Disclaimer: All products are for Research use only unless clearly stated otherwise on the product datasheet. Datasheets provided on the website are drafts for reference purpose only and you are requested to always refer to the hard copy included in the kit for your experimentation. Agdia Products are available for delivery only in Canada.

Proudly representing

150+ years of combined research-supply heritage

My Cart
Wishlist
Recently Viewed
Categories

Request Data Sheet / Safty Data Sheet

Please enable JavaScript in your browser to complete this form.
=

Price Request

Please enable JavaScript in your browser to complete this form.
=

Compare Products (11 Products)
For Research Use Only. All Immunomart products are sold strictly for laboratory research use only (RUO). Not for human or veterinary consumption, therapeutic, or diagnostic use.