VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

SKU T76250-5 mg Category Brand:

This product is currently out of stock and unavailable.

Products Details

Product Description

– VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, a 30-amino-acid peptide, mirrors the C-terminal domain of α2δ-1 and is recognized as the α2δ-1Tat peptide. It disrupts the α2δ-1 – NMDAR interaction both in vitro and in vivo, offering a potential research tool for neuropathic pain studies [1].

Web ID

– T76250

Storage Temperature

– -20℃

Shipping

– Blue Ice

Molecular Formula

– C171H250N40O39

CAS Number

– 2279952-25-7

Molecular Weight

– C171H250N40O39

SMILES

– C([C@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC1=CC=CC=C1)NC([C@@H](NC([C@@H](NC(CNC([C@H](CC2=CC=CC=C2)NC([C@@H](NC([C@@H](NC([C@H](CC=3C=4C(NC3)=CC=CC4)NC([C@@H](NC([C@@H](NC(=O)[C@H]5N(C([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@H](C(C)C)N)=O)CO)=O)=O)CC(C)C)=O)CC(N)=O)=O)CCC5)CO)=O)CC(C)C)=O)=O)CO)=O)[C@H](CC)C)=O)=O)=O)CC(C)C)=O)CCC(N)=O)=O)=O)[C@H](CC)C)=O)CC(C)C)=O)CC(C)C)=O)C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@@H](CC6=CN=CN6)C(N[C@@H](CC7=CC=C(O)C=C7)C(N[C@H](C(N[C@@H](CC=8C=9C(NC8)=CC=CC9)C(O)=O)=O)CC(C)C)=O)=O)=O)CCCNC(=N)N)=O)CO)=O)=O)CO)=O)C(C)C)=O)CC(C)C)=O)C=%10C=%11C(NC%10)=CC=CC%11

Product type

– Peptide

Disclaimer: All products are for Research use only unless clearly stated otherwise on the product datasheet. Datasheets provided on the website are drafts for reference purpose only and you are requested to always refer to the hard copy included in the kit for your experimentation. Agdia Products are available for delivery only in Canada.

My Cart
Wishlist
Recently Viewed
Categories

Request Data Sheet / Safty Data Sheet

Please enable JavaScript in your browser to complete this form.
=

Price Request

Please enable JavaScript in your browser to complete this form.
=

Compare Products (0 Products)
document.addEventListener('elementor/popup/show', function() { if (typeof turnstile !== 'undefined') { document.querySelectorAll('.cf-turnstile').forEach(function(el) { if (!el.dataset.rendered) { turnstile.render(el); el.dataset.rendered = true; } }); } });