Download Files:
For Research Use Only (RUO). This product is sold strictly for laboratory research use. Not for human or veterinary consumption, therapeutic, or diagnostic use.For sale to research organizations and laboratories only; not for patients or for personal use.
Products Details
Product Description
– VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, a 30-amino-acid peptide, mirrors the C-terminal domain of α2δ-1 and is recognized as the α2δ-1Tat peptide. It disrupts the α2δ-1 – NMDAR interaction both in vitro and in vivo, offering a potential research tool for neuropathic pain studies [1].
For Research Use Only (RUO). This product is sold strictly for laboratory research use only. Not for human or veterinary consumption, therapeutic, or diagnostic use. Any pharmacological, therapeutic, cosmetic, or biological effects described above are provided as research context only and do not represent intended or approved uses of this product.
Web ID
– T76250
Storage Temperature
– -20℃
Shipping
– Blue Ice
Molecular Formula
– C171H250N40O39
CAS Number
– 2279952-25-7
Molecular Weight
– C171H250N40O39
SMILES
– C([C@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC1=CC=CC=C1)NC([C@@H](NC([C@@H](NC(CNC([C@H](CC2=CC=CC=C2)NC([C@@H](NC([C@@H](NC([C@H](CC=3C=4C(NC3)=CC=CC4)NC([C@@H](NC([C@@H](NC(=O)[C@H]5N(C([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@H](C(C)C)N)=O)CO)=O)=O)CC(C)C)=O)CC(N)=O)=O)CCC5)CO)=O)CC(C)C)=O)=O)CO)=O)[C@H](CC)C)=O)=O)=O)CC(C)C)=O)CCC(N)=O)=O)=O)[C@H](CC)C)=O)CC(C)C)=O)CC(C)C)=O)C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@@H](CC6=CN=CN6)C(N[C@@H](CC7=CC=C(O)C=C7)C(N[C@H](C(N[C@@H](CC=8C=9C(NC8)=CC=CC9)C(O)=O)=O)CC(C)C)=O)=O)=O)CCCNC(=N)N)=O)CO)=O)=O)CO)=O)C(C)C)=O)CC(C)C)=O)C=%10C=%11C(NC%10)=CC=CC%11
Product type
– Peptide
Disclaimer: All products are for Research use only unless clearly stated otherwise on the product datasheet. Datasheets provided on the website are drafts for reference purpose only and you are requested to always refer to the hard copy included in the kit for your experimentation. Agdia Products are available for delivery only in Canada.
Related Products
D-JNKI-1 acetate
267 CAD – 2,368 CADPrice range: 267 CAD through 2,368 CAD
1000 in stock
1000 in stock
1000 in stock
Proudly representing
150+ years of combined research-supply heritage

