Download Files:

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA

SKU T76250L-5 mg Category Brand:

This product is currently out of stock and unavailable.

Request Pricing

Products Details

Product Description

– VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA), a 30-amino-acid peptide, mimics the C-terminal domain of α2δ-1, known as α2δ-1Tat peptide. This compound disrupts the α2δ-1 – NMDAR interaction both in vitro and in vivo, demonstrating potential utility in neuropathic pain research [1].

Web ID

– T76250L

Storage Temperature

– -20℃

Shipping

– Blue Ice

Molecular Formula

– C173H251F3N40O41

Molecular Weight

– C173H251F3N40O41

Product type

– Peptide

Booklet

Disclaimer: All products are for Research use only unless clearly stated otherwise on the product datasheet. Datasheets provided on the website are drafts for reference purpose only and you are requested to always refer to the hard copy included in the kit for your experimentation. Agdia Products are available for delivery only in Canada.

Related Products

Select options
Placeholder
Degarelix acetate(214766-78-6 free base) Price range: 112 CAD through 1,579 CAD
2 mg1 mg5 mg

1000 in stock

Select options
Ciraparantag acetate
Ciraparantag acetate Price range: 61 CAD through 861 CAD
2 mg1 mL * 10 mM (in DMSO)5 mg

1000 in stock

Select options
Bax inhibitor peptide V5
Bax inhibitor peptide V5 Price range: 139 CAD through 709 CAD
10 mg25 mg5 mg

1000 in stock

Add to cart
Angiotensin III
Angiotensin III 2,432 CAD

1000 in stock

Select options
Ac-Gly-BoroPro
Ac-Gly-BoroPro Price range: 2,432 CAD through 4,000 CAD
100 mg25 mg50 mg

1000 in stock

My Cart
Wishlist
Recently Viewed
Categories

Request Data Sheet / Safty Data Sheet

Please enable JavaScript in your browser to complete this form.
=

Price Request

Please enable JavaScript in your browser to complete this form.
=

Compare Products (0 Products)
document.addEventListener('elementor/popup/show', function() { if (typeof turnstile !== 'undefined') { document.querySelectorAll('.cf-turnstile').forEach(function(el) { if (!el.dataset.rendered) { turnstile.render(el); el.dataset.rendered = true; } }); } });