Download Files:
Products Details
Product Description
– VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA), a 30-amino-acid peptide, mimics the C-terminal domain of α2δ-1, known as α2δ-1Tat peptide. This compound disrupts the α2δ-1 – NMDAR interaction both in vitro and in vivo, demonstrating potential utility in neuropathic pain research [1].
Web ID
– T76250L
Storage Temperature
– -20℃
Shipping
– Blue Ice
Molecular Formula
– C173H251F3N40O41
Molecular Weight
– C173H251F3N40O41
Product type
– Peptide
Disclaimer: All products are for Research use only unless clearly stated otherwise on the product datasheet. Datasheets provided on the website are drafts for reference purpose only and you are requested to always refer to the hard copy included in the kit for your experimentation. Agdia Products are available for delivery only in Canada.
Related Products
D-JNKI-1 acetate
267 CAD – 2,368 CADPrice range: 267 CAD through 2,368 CAD
1000 in stock
Carnostatine hydrochloride
2,432 CAD – 4,000 CADPrice range: 2,432 CAD through 4,000 CAD
1000 in stock
1000 in stock
1000 in stock
1000 in stock