Download Files:
Products Details
Product Description
– STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, a peptide related to angiotensin-converting enzyme 2 (ACE2), is utilized in research to examine ACE2’s function [1].
Web ID
– T76200
Storage Temperature
– -20℃
Shipping
– Blue Ice
Molecular Formula
– C164H238N40O55
Molecular Weight
– C164H238N40O55
Product type
– Peptide
Disclaimer: All products are for Research use only unless clearly stated otherwise on the product datasheet. Datasheets provided on the website are drafts for reference purpose only and you are requested to always refer to the hard copy included in the kit for your experimentation. Agdia Products are available for delivery only in Canada.
Related Products
1000 in stock
1000 in stock
1000 in stock