Download Files:

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

SKU T76200-5 mg Category Brand:

This product is currently out of stock and unavailable.

Request Pricing

Products Details

Product Description

– STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, a peptide related to angiotensin-converting enzyme 2 (ACE2), is utilized in research to examine ACE2’s function [1].

Web ID

– T76200

Storage Temperature

– -20℃

Shipping

– Blue Ice

Molecular Formula

– C164H238N40O55

Molecular Weight

– C164H238N40O55

Product type

– Peptide

Booklet

Disclaimer: All products are for Research use only unless clearly stated otherwise on the product datasheet. Datasheets provided on the website are drafts for reference purpose only and you are requested to always refer to the hard copy included in the kit for your experimentation. Agdia Products are available for delivery only in Canada.

Related Products

Add to cart
Placeholder
D-JNKI-1 1,824 CAD

1000 in stock

Read more
Cyclo(Arg-Gly-Asp-D-Phe-Val) TFA
Cyclo(Arg-Gly-Asp-D-Phe-Val) TFA
Select options
BOC-D-FMK
BOC-D-FMK Price range: 75 CAD through 1,416 CAD
1 mg1 mL * 10 mM (in DMSO)5 mg

1000 in stock

Read more
Bactenecin
Bactenecin
Select options
Arg-Gly-Asp-Ser acetate
Arg-Gly-Asp-Ser acetate Price range: 56 CAD through 693 CAD
10 mg25 mg5 mg

1000 in stock

My Cart
Wishlist
Recently Viewed
Categories

Request Data Sheet / Safty Data Sheet

Please enable JavaScript in your browser to complete this form.
=

Price Request

Please enable JavaScript in your browser to complete this form.
=

Compare Products (0 Products)
document.addEventListener('elementor/popup/show', function() { if (typeof turnstile !== 'undefined') { document.querySelectorAll('.cf-turnstile').forEach(function(el) { if (!el.dataset.rendered) { turnstile.render(el); el.dataset.rendered = true; } }); } });