VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA

SKU T76250L-5 mg Category Brand:

This product is currently out of stock and unavailable.

Products Details

Product Description

– VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA), a 30-amino-acid peptide, mimics the C-terminal domain of α2δ-1, known as α2δ-1Tat peptide. This compound disrupts the α2δ-1 – NMDAR interaction both in vitro and in vivo, demonstrating potential utility in neuropathic pain research [1].

Web ID

– T76250L

Storage Temperature

– -20℃

Shipping

– Blue Ice

Molecular Formula

– C173H251F3N40O41

Molecular Weight

– C173H251F3N40O41

Product type

– Peptide

Disclaimer: All products are for Research use only unless clearly stated otherwise on the product datasheet. Datasheets provided on the website are drafts for reference purpose only and you are requested to always refer to the hard copy included in the kit for your experimentation. Agdia Products are available for delivery only in Canada.

My Cart
Wishlist
Recently Viewed
Categories

Request Data Sheet / Safty Data Sheet

Please enable JavaScript in your browser to complete this form.
=

Price Request

Please enable JavaScript in your browser to complete this form.
=

Compare Products (1 Product)