Download Files:
Products Details
Product Description
– Mecasermin (Human IGF-I; FK 780) is a recombinant human insulin-like growth factor I (IGF-I). Mecasermin has the potential for the study of the growth failure of growth hormone (GH) insensitivity caused by GH receptor defects or GH-inhibiting antibodies[1].
Web ID
– HY-108905
Shipping
– Room temperature
Applications
– Metabolism-protein/nucleotide metabolism
Molecular Formula
– C331H512N94O101S7
References
– [1]Arlan L Rosenbloom. Mecasermin (recombinant human insulin-like growth factor I). Adv Ther. 2009 Jan;26(1):40-54.|[2]Jorge Castro, et al. Functional recovery with recombinant human IGF1 treatment in a mouse model of Rett Syndrome. Proc Natl Acad Sci U S A. 2014 Jul 8;111(27):9941-6.
CAS Number
– 68562-41-4
Molecular Weight
– 7645.68
SMILES
– [GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDL
RRLEMYCAPLKPAKSA(Disulfide bridge:Cys6-Cys48;Cys18-Cys61;Cys47-Cys52)]
Clinical Information
– Launched
Research Area
– Metabolic Disease
Solubility
– 10 mM in DMSO
Target
– IGF-1R
Pathway
– Protein Tyrosine Kinase/RTK
Product type
– Peptides
Disclaimer: All products are for Research use only unless clearly stated otherwise on the product datasheet. Datasheets provided on the website are drafts for reference purpose only and you are requested to always refer to the hard copy included in the kit for your experimentation. Agdia Products are available for delivery only in Canada.
Related Products
1000 in stock
